CD40 Ligand anticorps

N° du produit ABIN634665

Cet anticorps anti-CD40 Ligand est un anticorps Lapin Polyclonal détectant CD40 Ligand dans WB. Adapté pour Humain.

Aperçu rapide pour CD40 Ligand anticorps (ABIN634665)

Antigène: CD40 Ligand (CD40LG)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD40 Ligand est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CD40 Ligand anticorps

Purification: Affinity purified

Immunogène: CD40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CD40L Blocking Peptide, (ABIN938001), is also available for use as a blocking control in assays to test for specificity of this CD40L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CD40 Ligand

Antigène: CD40 Ligand (CD40LG)

Autre désignation: CD40L

Sujet: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints