ADAM15 anticorps (Middle Region)

N° du produit ABIN634676

L’anticorps anti-ADAM15 Polyclonal Lapin est utilisé pour la détection de ADAM15 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour ADAM15 anticorps (Middle Region) (ABIN634676)

Antigène: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAM15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADAM15 anticorps

Épitope: Middle Region

Specificité: ADAM15 antibody was raised against the middle region of ADAM15

Purification: Affinity purified

Immunogène: ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAM15 Blocking Peptide, (ABIN5611932), is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAM15

Antigène: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Autre désignation: ADAM15

Sujet: ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.

Poids moléculaire: 70 kDa (MW of target protein)