ADAM15 anticorps (Middle Region)
-
- Antigène Voir toutes ADAM15 Anticorps
- ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAM15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADAM15 antibody was raised against the middle region of ADAM15
- Purification
- Affinity purified
- Immunogène
- ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ
- Top Product
- Discover our top product ADAM15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADAM15 Blocking Peptide, catalog no. 33R-7669, is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))
- Autre désignation
- ADAM15 (ADAM15 Produits)
- Sujet
- ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.
- Poids moléculaire
- 70 kDa (MW of target protein)
-