DLL1 anticorps

N° du produit ABIN634696

Détail du produit anti-DLL1 anticorps

Antigène: DLL1 (delta-Like 1 (DLL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLL1

Antigène: DLL1 (delta-Like 1 (DLL1))

Autre désignation: DLL1 (DLL1 Produits)

Synonymes: anticorps X-delta-1, anticorps XDelta1, anticorps Xdelta-1, anticorps delta, anticorps delta-1, anticorps delta1, anticorps x-delta, anticorps DELTA1, anticorps DL1, anticorps Delta, anticorps DLK, anticorps DLK-1, anticorps Delta1, anticorps FA1, anticorps PREF1, anticorps Pref-1, anticorps ZOG, anticorps pG2, anticorps DLL1, anticorps AW742678, anticorps DlkI, anticorps Ly107, anticorps Peg9, anticorps SCP1, anticorps pref-1, anticorps delta-like 1, anticorps delta like canonical Notch ligand 1, anticorps delta like non-canonical Notch ligand 1, anticorps delta-like 1 L homeolog, anticorps delta-like 1 (Drosophila), anticorps delta-like 1 homolog (Drosophila), anticorps dll1, anticorps DLL1, anticorps DLK1, anticorps Dll1, anticorps dll1.L, anticorps Dlk1

Sujet: DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Signalisation Notch, Stem Cell Maintenance