Claudin 11 anticorps

N° du produit ABIN634717

Cet anticorps Lapin Polyclonal détecte spécifiquement Claudin 11 dans WB et IHC. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour Claudin 11 anticorps (ABIN634717)

Antigène: Claudin 11 (CLDN11)

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 11 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Claudin 11 anticorps

Purification: Affinity purified

Immunogène: Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 11 Blocking Peptide, (ABIN5612905), is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 11

Antigène: Claudin 11 (CLDN11)

Autre désignation: Claudin 11

Sujet: CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Hepatitis C