GJD2 anticorps (Middle Region)

N° du produit ABIN634734

Cet anticorps anti-GJD2 est un anticorps Lapin Polyclonal détectant GJD2 dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour GJD2 anticorps (Middle Region) (ABIN634734)

Antigène: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJD2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GJD2 anticorps

Épitope: Middle Region

Specificité: GJD2 antibody was raised against the middle region of GJD2

Purification: Affinity purified

Immunogène: GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJD2 Blocking Peptide, (ABIN937950), is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJD2

Antigène: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Autre désignation: GJD2

Sujet: GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

Poids moléculaire: 36 kDa (MW of target protein)