PCDHA4 anticorps (C-Term)

N° du produit ABIN634737

Cet anticorps anti-PCDHA4 est un anticorps Lapin Polyclonal détectant PCDHA4 dans WB. Adapté pour Humain.

Aperçu rapide pour PCDHA4 anticorps (C-Term) (ABIN634737)

Antigène: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PCDHA4 anticorps

Épitope: C-Term

Specificité: PCDHA4 antibody was raised against the C terminal of PCDHA4

Purification: Affinity purified

Immunogène: PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA4 Blocking Peptide, (ABIN5615245), is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA4

Antigène: PCDHA4 (Protocadherin alpha 4 (PCDHA4))

Autre désignation: PCDHA4

Sujet: The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 99 kDa (MW of target protein)