PCDHA6 anticorps (C-Term)
-
- Antigène Voir toutes PCDHA6 Anticorps
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHA6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHA6 antibody was raised against the C terminal of PCDHA6
- Purification
- Affinity purified
- Immunogène
- PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY
- Top Product
- Discover our top product PCDHA6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHA6 (Protocadherin alpha 6 (PCDHA6))
- Autre désignation
- PCDHA6 (PCDHA6 Produits)
- Synonymes
- anticorps CNR2, anticorps CNRN2, anticorps CNRS2, anticorps CRNR2, anticorps PCDH-ALPHA6, anticorps CNR, anticorps Cnr2, anticorps Crnr2, anticorps rCNRv06, anticorps PCDHA3, anticorps PCDHA6, anticorps PCDHA7, anticorps PCDHA9, anticorps protocadherin alpha 6, anticorps PCDHA6, anticorps Pcdha6
- Sujet
- PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Poids moléculaire
- 84 kDa (MW of target protein)
-