ITFG1 anticorps (N-Term)

N° du produit ABIN634749

Détail du produit anti-ITFG1 anticorps

Antigène: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITFG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ITFG1 antibody was raised against the N terminal of ITFG1

Purification: Affinity purified

Immunogène: ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITFG1 Blocking Peptide, catalog no. 33R-8970, is also available for use as a blocking control in assays to test for specificity of this ITFG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITFG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITFG1

Antigène: ITFG1 (Integrin alpha FG-GAP Repeat Containing 1 (ITFG1))

Autre désignation: ITFG1 (ITFG1 Produits)

Synonymes: anticorps ITFG1, anticorps DKFZp459J0328, anticorps TIP, anticorps 2310047C21Rik, anticorps AI314457, anticorps Cda08, anticorps D8Wsu49e, anticorps integrin alpha FG-GAP repeat containing 1, anticorps T-cell immunomodulatory protein, anticorps ITFG1, anticorps itfg1, anticorps LOC100550296, anticorps Itfg1

Sujet: ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.

Poids moléculaire: 68 kDa (MW of target protein)