Cadherin 7 anticorps (N-Term)

N° du produit ABIN634751

Détail du produit anti-Cadherin 7 anticorps

Antigène: Cadherin 7 (CDH7)

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin 7 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDH7 antibody was raised against the N terminal of CDH7

Purification: Affinity purified

Immunogène: CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH7 Blocking Peptide, catalog no. 33R-7167, is also available for use as a blocking control in assays to test for specificity of this CDH7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin 7

Antigène: Cadherin 7 (CDH7)

Autre désignation: CDH7 (CDH7 Produits)

Synonymes: anticorps CDH7L1, anticorps Cad7, anticorps 9330156F07Rik, anticorps cadherin 7, anticorps cadherin 7, type 2, anticorps cadherin 7a, anticorps CDH7, anticorps Cdh7, anticorps cdh7a

Sujet: CDH7 is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization