CDH23 anticorps (Middle Region)

N° du produit ABIN634752

Cet anticorps anti-CDH23 est un anticorps Lapin Polyclonal détectant CDH23 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour CDH23 anticorps (Middle Region) (ABIN634752)

Antigène: CDH23 (Cadherin 23 (CDH23))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDH23 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CDH23 anticorps

Épitope: Middle Region

Specificité: CDH23 antibody was raised against the middle region of CDH23

Purification: Affinity purified

Immunogène: CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH23 Blocking Peptide, (ABIN937626), is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDH23

Antigène: CDH23 (Cadherin 23 (CDH23))

Autre désignation: CDH23

Sujet: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound