DGCR2 anticorps (N-Term)

N° du produit ABIN634763

L’anticorps Lapin Polyclonal anti-DGCR2 a été validé pour WB. Il convient pour détecter DGCR2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour DGCR2 anticorps (N-Term) (ABIN634763)

Antigène: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGCR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DGCR2 anticorps

Épitope: N-Term

Specificité: DGCR2 antibody was raised against the N terminal of DGCR2

Purification: Affinity purified

Immunogène: DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGCR2 Blocking Peptide, (ABIN5613186), is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGCR2

Antigène: DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))

Autre désignation: DGCR2

Sujet: DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.

Poids moléculaire: 61 kDa (MW of target protein)