APP anticorps (Middle Region)

N° du produit ABIN634767

Cet anticorps anti-APP est un anticorps Lapin Polyclonal détectant APP dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour APP anticorps (Middle Region) (ABIN634767)

Antigène: APP (Amyloid beta (A4) Precursor Protein (APP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-APP anticorps

Épitope: Middle Region

Specificité: APP antibody was raised against the middle region of APP

Purification: Affinity purified

Immunogène: APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APP Blocking Peptide, (ABIN5612126), is also available for use as a blocking control in assays to test for specificity of this APP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APP

Antigène: APP (Amyloid beta (A4) Precursor Protein (APP))

Autre désignation: APP

Sujet: APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Caspase Cascade in Apoptosis, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour