Thrombopoietin anticorps

N° du produit ABIN634773

Cet anticorps anti-Thrombopoietin est un anticorps Lapin Polyclonal détectant Thrombopoietin dans WB. Adapté pour Humain.

Aperçu rapide pour Thrombopoietin anticorps (ABIN634773)

Antigène: Thrombopoietin (THPO)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Thrombopoietin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Thrombopoietin anticorps

Purification: Affinity purified

Immunogène: Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Thrombopoietin Blocking Peptide, (ABIN5616592), is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Thrombopoietin

Antigène: Thrombopoietin (THPO)

Autre désignation: Thrombopoietin

Sujet: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hormone Activity