Thrombopoietin anticorps

N° du produit ABIN634773

Détail du produit anti-Thrombopoietin anticorps

Antigène: Thrombopoietin (THPO)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Thrombopoietin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Thrombopoietin

Antigène: Thrombopoietin (THPO)

Autre désignation: Thrombopoietin (THPO Produits)

Synonymes: anticorps MGDF, anticorps MKCSF, anticorps ML, anticorps MPLLG, anticorps THCYT1, anticorps TPO, anticorps Mgdf, anticorps Ml, anticorps Mpllg, anticorps Tpo, anticorps Tpo1, anticorps Tpo2, anticorps Tpo3, anticorps Tpo4, anticorps tpo, anticorps LOC100231762, anticorps thrombopoietin, anticorps THPO, anticorps Thpo, anticorps thpo

Sujet: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hormone Activity