Norrie Disease (Pseudoglioma) anticorps

N° du produit ABIN634783

Cet anticorps Lapin Polyclonal détecte spécifiquement Norrie Disease (Pseudoglioma) dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Norrie Disease (Pseudoglioma) anticorps (ABIN634783)

Antigène: Norrie Disease (Pseudoglioma) (NDP)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Norrie Disease (Pseudoglioma) est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Norrie Disease (Pseudoglioma) anticorps

Purification: Affinity purified

Immunogène: NDP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDP Blocking Peptide, (ABIN937500), is also available for use as a blocking control in assays to test for specificity of this NDP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Norrie Disease (Pseudoglioma)

Antigène: Norrie Disease (Pseudoglioma) (NDP)

Autre désignation: NDP

Sujet: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1).

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Sensory Perception of Sound