Stanniocalcin 1 anticorps (N-Term)

N° du produit ABIN634788

Détail du produit anti-Stanniocalcin 1 anticorps

Antigène: Stanniocalcin 1 (STC1)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Stanniocalcin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: STC1 antibody was raised against the N terminal of STC1

Purification: Affinity purified

Immunogène: STC1 antibody was raised using the N terminal of STC1 corresponding to a region with amino acids MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STC1 Blocking Peptide, catalog no. 33R-6205, is also available for use as a blocking control in assays to test for specificity of this STC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Stanniocalcin 1

Antigène: Stanniocalcin 1 (STC1)

Autre désignation: STC1 (STC1 Produits)

Synonymes: anticorps STC, anticorps Stc, anticorps stc1, anticorps MGC82280, anticorps STC1, anticorps zgc:153307, anticorps LOC777959, anticorps stanniocalcin 1, anticorps stanniocalcin 1 L homeolog, anticorps stanniocalcin 1 S homeolog, anticorps STC1, anticorps Stc1, anticorps stc1.L, anticorps stc1.S, anticorps stc1, anticorps LOC777959

Sujet: STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Hormone Activity