IL-4 anticorps (Middle Region)

N° du produit ABIN634805

L’anticorps anti-IL-4 Polyclonal Lapin est utilisé pour la détection de IL-4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour IL-4 anticorps (Middle Region) (ABIN634805)

Antigène: IL-4 (IL4) (Interleukin 4 (IL4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-4 anticorps

Épitope: Middle Region

Specificité: IL4 antibody was raised against the middle region of IL4

Purification: Affinity purified

Immunogène: IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL4 Blocking Peptide, (ABIN940448), is also available for use as a blocking control in assays to test for specificity of this IL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-4

Antigène: IL-4 (IL4) (Interleukin 4 (IL4))

Autre désignation: IL4

Sujet: IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation