IL-5 anticorps

N° du produit ABIN634806

Cet anticorps anti-IL-5 est un anticorps Lapin Polyclonal détectant IL-5 dans WB. Adapté pour Humain.

Aperçu rapide pour IL-5 anticorps (ABIN634806)

Antigène: IL-5 (IL5) (Interleukin 5 (IL5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-5 anticorps

Purification: Affinity purified

Immunogène: IL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL5 Blocking Peptide, (ABIN940314), is also available for use as a blocking control in assays to test for specificity of this IL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-5

Antigène: IL-5 (IL5) (Interleukin 5 (IL5))

Autre désignation: IL5

Sujet: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Feeding Behaviour