ABCC9 anticorps

N° du produit ABIN634823

L’anticorps Lapin Polyclonal anti-ABCC9 a été validé pour WB. Il convient pour détecter ABCC9 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ABCC9 anticorps (ABIN634823)

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC9 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABCC9 anticorps

Purification: Affinity purified

Immunogène: ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCC9 Blocking Peptide, (ABIN937006), is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCC9

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Autre désignation: ABCC9

Sujet: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.

Poids moléculaire: 174 kDa (MW of target protein)