ABCC9 anticorps
-
- Antigène Voir toutes ABCC9 Anticorps
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
-
Reactivité
- Souris, Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCC9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
- Top Product
- Discover our top product ABCC9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))
- Autre désignation
- ABCC9 (ABCC9 Produits)
- Synonymes
- anticorps SUR2B, anticorps DDBDRAFT_0215814, anticorps DDBDRAFT_0216237, anticorps DDB_0215814, anticorps DDB_0216237, anticorps si:dkey-183c2.3, anticorps sur2, anticorps ABC37, anticorps ATFB12, anticorps CANTU, anticorps CMD1O, anticorps SUR2, anticorps SUR2A, anticorps AI414027, anticorps AI449286, anticorps Sur2, anticorps ABCC9, anticorps ATP binding cassette subfamily C member 9, anticorps ATP-binding cassette sub-family C member 8, anticorps ABC transporter C family protein, anticorps ATP-binding cassette sub-family C member 9, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 9, anticorps ABCC9, anticorps LOC581821, anticorps abcC9, anticorps LOC100470981, anticorps abcc9, anticorps Abcc9
- Sujet
- ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.
- Poids moléculaire
- 174 kDa (MW of target protein)
-