SLC39A7 anticorps

N° du produit ABIN634829

Détail du produit anti-SLC39A7 anticorps

Antigène: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A7 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC39 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A7 Blocking Peptide, catalog no. 33R-3709, is also available for use as a blocking control in assays to test for specificity of this SLC39A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A7

Antigène: SLC39A7 (Solute Carrier Family 39 (Zinc Transporter), Member 7 (SLC39A7))

Autre désignation: SLC39A7 (SLC39A7 Produits)

Synonymes: anticorps ke4, anticorps HKE4, anticorps id:ibd5081, anticorps wu:fc28c09, anticorps hke4, anticorps zip7, anticorps ring5, anticorps h2-ke4, anticorps d6s115e, anticorps d6s2244e, anticorps D6S115E, anticorps D6S2244E, anticorps H2-KE4, anticorps KE4, anticorps RING5, anticorps ZIP7, anticorps AA408174, anticorps AI117660, anticorps AL024048, anticorps H-2Ke4, anticorps H2-Ke4, anticorps Ke-4, anticorps Ke4, anticorps Ring5, anticorps Zip7, anticorps RT1-Ke4, anticorps Rt1Ke4, anticorps solute carrier family 39 (zinc transporter), member 7, anticorps solute carrier family 39 member 7, anticorps solute carrier family 39 member 7 L homeolog, anticorps zinc transporter protein ZIP7, anticorps slc39a7, anticorps SLC39A7, anticorps slc39a7.L, anticorps Slc39a7, anticorps zip7

Sujet: Zinc is an essential cofactor for more than 50 classes of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. Zinc cannot passively diffuse across cell membranes and requires specific transporters, such as SLC39A7, to enter the cytosol from both the extracellular environment and from intracellular storage compartments.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis