PARP16 anticorps

N° du produit ABIN634849

Détail du produit anti-PARP16 anticorps

Antigène: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP16 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP16 Blocking Peptide, catalog no. 33R-4620, is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP16

Antigène: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Autre désignation: PARP16 (PARP16 Produits)

Synonymes: anticorps PARP16, anticorps zgc:77744, anticorps ARTD15, anticorps C15orf30, anticorps pART15, anticorps BC055447, anticorps C79952, anticorps PARP-16, anticorps LRRGT00109, anticorps RGD1306243, anticorps poly(ADP-ribose) polymerase family member 16, anticorps poly(ADP-ribose) polymerase family member 16 L homeolog, anticorps poly (ADP-ribose) polymerase family, member 16, anticorps PARP16, anticorps parp16.L, anticorps parp16, anticorps Parp16

Sujet: Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.

Poids moléculaire: 36 kDa (MW of target protein)