PARP16 anticorps
-
- Antigène Voir toutes PARP16 Anticorps
- PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PARP16 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD
- Top Product
- Discover our top product PARP16 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARP16 Blocking Peptide, catalog no. 33R-4620, is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))
- Autre désignation
- PARP16 (PARP16 Produits)
- Synonymes
- anticorps PARP16, anticorps zgc:77744, anticorps ARTD15, anticorps C15orf30, anticorps pART15, anticorps BC055447, anticorps C79952, anticorps PARP-16, anticorps LRRGT00109, anticorps RGD1306243, anticorps poly(ADP-ribose) polymerase family member 16, anticorps poly(ADP-ribose) polymerase family member 16 L homeolog, anticorps poly (ADP-ribose) polymerase family, member 16, anticorps PARP16, anticorps parp16.L, anticorps parp16, anticorps Parp16
- Sujet
- Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.
- Poids moléculaire
- 36 kDa (MW of target protein)
-