CMTM2 anticorps (N-Term)
-
- Antigène Voir toutes CMTM2 Anticorps
- CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CMTM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CMTM2 antibody was raised against the N terminal of CMTM2
- Purification
- Affinity purified
- Immunogène
- CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL
- Top Product
- Discover our top product CMTM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CMTM2 Blocking Peptide, catalog no. 33R-2029, is also available for use as a blocking control in assays to test for specificity of this CMTM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))
- Autre désignation
- CMTM2 (CMTM2 Produits)
- Synonymes
- anticorps CKLFSF2, anticorps CKLF like MARVEL transmembrane domain containing 2, anticorps CMTM2
- Sujet
- CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
- Poids moléculaire
- 27 kDa (MW of target protein)
-