HRK anticorps
-
- Antigène Voir toutes HRK Anticorps
- HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HRK est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HRK antibody was raised using a synthetic peptide corresponding to a region with amino acids MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
- Top Product
- Discover our top product HRK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HRK Blocking Peptide, catalog no. 33R-5817, is also available for use as a blocking control in assays to test for specificity of this HRK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HRK (Harakiri, BCL2 Interacting Protein (Contains Only BH3 Domain) (HRK))
- Autre désignation
- HRK (HRK Produits)
- Synonymes
- anticorps DP5, anticorps HARAKIRI, anticorps AI838259, anticorps Bid3, anticorps harakiri, anticorps Dp5, anticorps harakiri, BCL2 interacting protein, anticorps harakiri, BCL2 interacting protein (contains only BH3 domain), anticorps HRK, anticorps Hrk
- Sujet
- Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members.
- Poids moléculaire
- 10 kDa (MW of target protein)
-