Surfeit 4 anticorps (N-Term)

N° du produit ABIN634922

Détail du produit anti-Surfeit 4 anticorps

Antigène: Surfeit 4 (SURF4)

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Surfeit 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SURF4 antibody was raised against the N terminal of SURF4

Purification: Affinity purified

Immunogène: SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SURF4 Blocking Peptide, catalog no. 33R-3504, is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Surfeit 4

Antigène: Surfeit 4 (SURF4)

Autre désignation: SURF4 (SURF4 Produits)

Synonymes: anticorps CG6202, anticorps Dmel\\CG6202, anticorps SURF-4, anticorps Surf-4, anticorps SURF4, anticorps MGC88894, anticorps GB14656, anticorps Surf4, anticorps DKFZp459A164, anticorps ERV29, anticorps erv29, anticorps surf4, anticorps zgc:65806, anticorps zgc:77007, anticorps AL033340, anticorps AL033373, anticorps Surfeit 4, anticorps surfeit 4, anticorps surfeit 4, gene 1, anticorps surfeit locus protein 4 homolog, anticorps surfeit 4, gene 1 L homeolog, anticorps surfeit gene 4, anticorps Surf4, anticorps SURF4, anticorps surf4.1, anticorps LOC552234, anticorps surf4.1.L, anticorps surf4

Sujet: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.

Poids moléculaire: 30 kDa (MW of target protein)