TRIM59 anticorps (N-Term)

N° du produit ABIN634923

Cet anticorps anti-TRIM59 est un anticorps Lapin Polyclonal détectant TRIM59 dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour TRIM59 anticorps (N-Term) (ABIN634923)

Antigène: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM59 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRIM59 anticorps

Épitope: N-Term

Specificité: TRIM59 antibody was raised against the N terminal of TRIM59

Purification: Affinity purified

Immunogène: TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM59 Blocking Peptide, (ABIN5616789), is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM59

Antigène: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Autre désignation: TRIM59

Sujet: The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome