ENTPD8 anticorps (N-Term)

N° du produit ABIN634955

Détail du produit anti-ENTPD8 anticorps

Antigène: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ENTPD8 est non-conjugé

Application: Western Blotting (WB)

Specificité: ENTPD8 antibody was raised against the N terminal of ENTPD8

Purification: Affinity purified

Immunogène: ENTPD8 antibody was raised using the N terminal of ENTPD8 corresponding to a region with amino acids IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENTPD8 Blocking Peptide, catalog no. 33R-4087, is also available for use as a blocking control in assays to test for specificity of this ENTPD8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ENTPD8

Antigène: ENTPD8 (Ectonucleoside Triphosphate diphosphohydrolase 8 (ENTPD8))

Autre désignation: ENTPD8 (ENTPD8 Produits)

Synonymes: anticorps GLSR2492, anticorps NTPDase-8, anticorps UNQ2492, anticorps ENTPD1, anticorps zC10E8.4, anticorps zgc:92065, anticorps si:ch211-10e8.4, anticorps ectonucleoside triphosphate diphosphohydrolase 8, anticorps ectonucleoside triphosphate diphosphohydrolase 8 L homeolog, anticorps ENTPD8, anticorps Entpd8, anticorps entpd8, anticorps entpd8.L, anticorps Tsp_07798

Sujet: ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Poids moléculaire: 54 kDa (MW of target protein)