PARL anticorps (N-Term)

N° du produit ABIN634971

Cet anticorps anti-PARL est un anticorps Lapin Polyclonal détectant PARL dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour PARL anticorps (N-Term) (ABIN634971)

Antigène: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PARL anticorps

Épitope: N-Term

Specificité: PARL antibody was raised against the N terminal of PARL

Purification: Affinity purified

Immunogène: PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARL Blocking Peptide, (ABIN5615220), is also available for use as a blocking control in assays to test for specificity of this PARL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARL

Antigène: PARL (Presenilin Associated, Rhomboid-Like (PARL))

Autre désignation: PARL

Sujet: PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Autophagy