SPPL2B anticorps (N-Term)

N° du produit ABIN634985

L’anticorps Lapin Polyclonal anti-SPPL2B a été validé pour WB et IHC. Il convient pour détecter SPPL2B dans des échantillons de Humain.

Aperçu rapide pour SPPL2B anticorps (N-Term) (ABIN634985)

Antigène: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPPL2B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SPPL2B anticorps

Épitope: N-Term

Specificité: SPPL2 B antibody was raised against the N terminal of SPPL2

Purification: Affinity purified

Immunogène: SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPPL2B Blocking Peptide, (ABIN5616378), is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPPL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPPL2B

Antigène: SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))

Autre désignation: SPPL2B

Sujet: SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.

Poids moléculaire: 56 kDa (MW of target protein)