ALG11 anticorps
-
- Antigène Voir toutes ALG11 Anticorps
- ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALG11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALG11 antibody was yeast alpha-12-mannosyltransferase
- Purification
- Affinity purified
- Immunogène
- ALG11 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA
- Top Product
- Discover our top product ALG11 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALG11 Blocking Peptide, catalog no. 33R-5418, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))
- Autre désignation
- ALG11 (ALG11 Produits)
- Synonymes
- anticorps UTP14C, anticorps CDG1P, anticorps GT8, anticorps RGD1564725, anticorps AI849156, anticorps AW492253, anticorps B230397C21, anticorps si:dkey-1h24.5, anticorps wu:fj04e04, anticorps asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase, anticorps ALG11, alpha-1,2-mannosyltransferase, anticorps ALG11, alpha-1,2-mannosyltransferase L homeolog, anticorps asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase), anticorps alg11, anticorps ALG11, anticorps alg11.L, anticorps Alg11
- Sujet
- ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-