HLA-F anticorps (N-Term)

N° du produit ABIN635005

Cet anticorps Lapin Polyclonal détecte spécifiquement HLA-F dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour HLA-F anticorps (N-Term) (ABIN635005)

Antigène: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLA-F est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HLA-F anticorps

Épitope: N-Term

Specificité: HLA-F antibody was raised against the N terminal of HLA-F

Purification: Affinity purified

Immunogène: HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HLA-F Blocking Peptide, (ABIN5614021), is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HLA-F

Antigène: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Autre désignation: HLA-F

Sujet: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response