HLA-F anticorps (N-Term)
-
- Antigène Voir toutes HLA-F (HLAF) Anticorps
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HLA-F est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HLA-F antibody was raised against the N terminal of HLA-F
- Purification
- Affinity purified
- Immunogène
- HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
- Top Product
- Discover our top product HLAF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HLA-F Blocking Peptide, catalog no. 33R-7437, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
- Autre désignation
- HLA-F (HLAF Produits)
- Synonymes
- anticorps HLAF, anticorps CDA12, anticorps HLA-5.4, anticorps HLA-CDA12, anticorps major histocompatibility complex, class I, F, anticorps HLA-F
- Sujet
- HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-