MFN2 anticorps (C-Term)

N° du produit ABIN635034

Cet anticorps anti-MFN2 est un anticorps Lapin Polyclonal détectant MFN2 dans WB. Adapté pour Humain et Rat.

Aperçu rapide pour MFN2 anticorps (C-Term) (ABIN635034)

Antigène: MFN2 (Mitofusin 2 (MFN2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFN2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MFN2 anticorps

Épitope: C-Term

Specificité: Mitofusin 2 antibody was raised against the C terminal of MFN2

Purification: Affinity purified

Immunogène: Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Mitofusin 2 Blocking Peptide, (ABIN940309), is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFN2

Antigène: MFN2 (Mitofusin 2 (MFN2))

Autre désignation: Mitofusin 2

Sujet: MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development