SLC25A32 anticorps (Middle Region)

N° du produit ABIN635047

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC25A32 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SLC25A32 anticorps (Middle Region) (ABIN635047)

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A32 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A32 anticorps

Épitope: Middle Region

Specificité: SLC25 A32 antibody was raised against the middle region of SLC25 32

Purification: Affinity purified

Immunogène: SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A32 Blocking Peptide, (ABIN5616220), is also available for use as a blocking control in assays to test for specificity of this SLC25A32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A32

Antigène: SLC25A32 (Solute Carrier Family 25, Member 32 (SLC25A32))

Autre désignation: SLC25A32

Sujet: SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport