Monoamine Oxidase B anticorps (C-Term)

N° du produit ABIN635051

Détail du produit anti-Monoamine Oxidase B anticorps

Antigène: Monoamine Oxidase B (MAOB)

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase B est non-conjugé

Application: Western Blotting (WB)

Specificité: MAOB antibody was raised against the C terminal of MAOB

Purification: Affinity purified

Immunogène: MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAOB Blocking Peptide, catalog no. 33R-3365, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Monoamine Oxidase B

Antigène: Monoamine Oxidase B (MAOB)

Autre désignation: MAOB (MAOB Produits)

Synonymes: anticorps MAOB, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps MAOA, anticorps 6330414K01Rik, anticorps MAO-B, anticorps monoamine oxidase B, anticorps amine oxidase [flavin-containing] B, anticorps monoamine oxidase, anticorps monoamine oxidase B L homeolog, anticorps MAOB, anticorps Gbro_4276, anticorps LOC100223232, anticorps mao, anticorps Maob, anticorps maob.L

Sujet: MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Poids moléculaire: 59 kDa (MW of target protein)