SLC25A21 anticorps

N° du produit ABIN635066

L’anticorps anti-SLC25A21 Polyclonal Lapin est utilisé pour la détection de SLC25A21 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SLC25A21 anticorps (ABIN635066)

Antigène: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A21 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A21 anticorps

Purification: Affinity purified

Immunogène: SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A21 Blocking Peptide, (ABIN5616213), is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A21

Antigène: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Autre désignation: SLC25A21

Sujet: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome