SLC25A20 anticorps

N° du produit ABIN635078

L’anticorps anti-SLC25A20 Polyclonal Lapin est utilisé pour la détection de SLC25A20 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour SLC25A20 anticorps (ABIN635078)

Antigène: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A20 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A20 anticorps

Purification: Affinity purified

Immunogène: SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A20 Blocking Peptide, (ABIN5616212), is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A20

Antigène: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Autre désignation: SLC25A20

Sujet: SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades