EPO anticorps (Middle Region)

N° du produit ABIN635113

Cet anticorps Lapin Polyclonal détecte spécifiquement EPO dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour EPO anticorps (Middle Region) (ABIN635113)

Antigène: EPO (Erythropoietin (EPO))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPO est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EPO anticorps

Épitope: Middle Region

Specificité: EPO antibody was raised against the middle region of EPO

Purification: Affinity purified

Immunogène: EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPO Blocking Peptide, (ABIN939701), is also available for use as a blocking control in assays to test for specificity of this EPO antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPO

Antigène: EPO (Erythropoietin (EPO))

Autre désignation: EPO

Classe de substances: Hormone

Sujet: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity