EPO anticorps (Middle Region)
-
- Antigène Voir toutes EPO Anticorps
- EPO (Erythropoietin (EPO))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EPO est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EPO antibody was raised against the middle region of EPO
- Purification
- Affinity purified
- Immunogène
- EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
- Top Product
- Discover our top product EPO Anticorps primaire
-
anti-Erythropoietin (EPO) (AA 28-193) antibody
EPO Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) (AA 28-193) antibodyEPO Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal D2 unconjugated
anti-Erythropoietin (EPO) (AA 101-193) antibodyEPO Reactivité: Humain, Rat WB, ELISA, FACS, IHC (p), IF (p), IF (cc), IHC (fro), DB Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) antibodyEPO Reactivité: Humain, Souris, Rat WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) (AA 28-162) antibodyEPO Reactivité: Humain WB, ELISA, IHC, Coat, StM Hôte: Souris Monoclonal EPO-1368 unconjugated
anti-Erythropoietin (EPO) (AA 28-162) antibodyEPO Reactivité: Humain ELISA, IHC, Coat, StM Hôte: Souris Monoclonal EPO-1367 unconjugated
anti-Erythropoietin (EPO) (AA 20-48) antibodyEPO Reactivité: Humain, Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) antibodyEPO Reactivité: Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) (AA 28-191) antibodyEPO Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Erythropoietin (EPO) antibodyEPO Reactivité: Humain WB, ELISA, ICC Hôte: Souris Monoclonal 4F11 unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EPO Blocking Peptide, catalog no. 33R-4315, is also available for use as a blocking control in assays to test for specificity of this EPO antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPO antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EPO (Erythropoietin (EPO))
- Autre désignation
- EPO (EPO Produits)
- Synonymes
- anticorps EPO, anticorps EP, anticorps MVCD2, anticorps erythropoietin, anticorps erythropoietin S homeolog, anticorps erythropoietin a, anticorps EPO, anticorps epo, anticorps epo.S, anticorps Epo, anticorps epoa
- Classe de substances
- Hormone
- Sujet
- This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.
- Poids moléculaire
- 18 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Hormone Activity, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity
-
