SPTLC1 anticorps (Middle Region)

N° du produit ABIN635127

Cité dans 1 publication. Cet anticorps anti-SPTLC1 Polyclonal Lapin (ABIN635127) détecte spécifiquement SPTLC1 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SPTLC1 anticorps (Middle Region) (ABIN635127)

Antigène: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPTLC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SPTLC1 anticorps

Épitope: Middle Region

Specificité: SPTLC1 antibody was raised against the middle region of SPTLC1

Purification: Affinity purified

Immunogène: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPTLC1 Blocking Peptide, (ABIN939291), is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-SPTLC1 (ABIN635127)

Klas, Copic, Direder, Laggner, Prucksamas, Gruber, Ankersmit, Mildner: "Transcriptional Differences in Lipid-Metabolizing Enzymes in Murine Sebocytes Derived from Sebaceous Glands of the Skin and Preputial Glands." dans: International journal of molecular sciences, Vol. 22, Issue 21, (2021) (PubMed).

Détails sur SPTLC1

Antigène: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Autre désignation: SPTLC1

Sujet: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Poids moléculaire: 53 kDa (MW of target protein)