ACSL5 anticorps (C-Term)

N° du produit ABIN635129

Détail du produit anti-ACSL5 anticorps

Antigène: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACSL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACSL5 antibody was raised against the C terminal of ACSL5

Purification: Affinity purified

Immunogène: ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL5 Blocking Peptide, catalog no. 33R-1075, is also available for use as a blocking control in assays to test for specificity of this ACSL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACSL5

Antigène: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Autre désignation: ACSL5 (ACSL5 Produits)

Synonymes: anticorps ACSL5, anticorps acs2, anticorps acs5, anticorps facl5, anticorps ACS2, anticorps ACS5, anticorps FACL5, anticorps 1700030F05Rik, anticorps Facl5, anticorps Acs5, anticorps zgc:92083, anticorps acyl-CoA synthetase long chain family member 5, anticorps acyl-CoA synthetase long-chain family member 5, anticorps ACSL5, anticorps acsl5, anticorps Acsl5

Sujet: ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Poids moléculaire: 76 kDa (MW of target protein)