Anoctamin 6 anticorps (Middle Region)

N° du produit ABIN635138

Détail du produit anti-Anoctamin 6 anticorps

Antigène: Anoctamin 6 (ANO6)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Anoctamin 6 est non-conjugé

Application: Western Blotting (WB)

Specificité: Anoctamin 6 antibody was raised against the middle region of ANO6

Purification: Affinity purified

Immunogène: Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Anoctamin 6

Antigène: Anoctamin 6 (ANO6)

Autre désignation: Anoctamin 6 (ANO6 Produits)

Synonymes: anticorps TMEM16F, anticorps 2900059G15Rik, anticorps AA407480, anticorps AW554778, anticorps F730003B03Rik, anticorps Tmem16f, anticorps BDPLT7, anticorps SCTS, anticorps anoctamin 6, anticorps ANO6, anticorps ano6, anticorps Ano6

Sujet: TMEM16F may act as a calcium-activated chloride channel.

Poids moléculaire: 106 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome