Synaptophysin anticorps (N-Term)

N° du produit ABIN635142

Cet anticorps anti-Synaptophysin est un anticorps Lapin Polyclonal détectant Synaptophysin dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour Synaptophysin anticorps (N-Term) (ABIN635142)

Antigène: Synaptophysin (SYP)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Synaptophysin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Synaptophysin anticorps

Épitope: N-Term

Specificité: Synaptophysin antibody was raised against the N terminal of SYP

Purification: Affinity purified

Immunogène: Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Synaptophysin Blocking Peptide, (ABIN5616473), is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Synaptophysin

Antigène: Synaptophysin (SYP)

Autre désignation: Synaptophysin

Sujet: Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity