LRRC4C anticorps (N-Term)

N° du produit ABIN635150

Détail du produit anti-LRRC4C anticorps

Antigène: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC4C est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC4 C antibody was raised against the N terminal of LRRC4

Purification: Affinity purified

Immunogène: LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC4C Blocking Peptide, catalog no. 33R-5546, is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC4C

Antigène: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Autre désignation: LRRC4C (LRRC4C Produits)

Synonymes: anticorps 6430556C10Rik, anticorps NGL-1, anticorps mKIAA1580, anticorps RGD1311013, anticorps fd12d10, anticorps wu:fd12d10, anticorps zgc:110565, anticorps NGL1, anticorps leucine rich repeat containing 4C, anticorps Lrrc4c, anticorps lrrc4c, anticorps LRRC4C

Sujet: NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Synaptic Membrane