DLL4 anticorps

N° du produit ABIN635181

Cet anticorps anti-DLL4 est un anticorps Lapin Polyclonal détectant DLL4 dans WB. Adapté pour Humain.

Aperçu rapide pour DLL4 anticorps (ABIN635181)

Antigène: DLL4 (delta-Like 4 (DLL4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLL4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLL4 anticorps

Purification: Affinity purified

Immunogène: DLL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLL4 Blocking Peptide, (ABIN5613220), is also available for use as a blocking control in assays to test for specificity of this DLL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLL4

Antigène: DLL4 (delta-Like 4 (DLL4))

Autre désignation: DLL4

Sujet: Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Signalisation Notch