KREMEN1 anticorps (N-Term)

N° du produit ABIN635197

Détail du produit anti-KREMEN1 anticorps

Antigène: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KREMEN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KREMEN1 antibody was raised against the N terminal of KREMEN1

Purification: Affinity purified

Immunogène: KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KREMEN1 Blocking Peptide, catalog no. 33R-9967, is also available for use as a blocking control in assays to test for specificity of this KREMEN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KREMEN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KREMEN1

Antigène: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Autre désignation: KREMEN1 (KREMEN1 Produits)

Synonymes: anticorps KREMEN1, anticorps krm1, anticorps kremen, anticorps kremem1, anticorps KREMEN, anticorps KRM1, anticorps AV002070, anticorps Kremen, anticorps Krm1, anticorps si:ct737139.1, anticorps si:dkeyp-7c9.1, anticorps kringle containing transmembrane protein 1, anticorps kringle containing transmembrane protein 1 S homeolog, anticorps KREMEN1, anticorps kremen1, anticorps Kremen1, anticorps kremen1.S

Sujet: KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Signalisation WNT