GCS1 anticorps (N-Term)

N° du produit ABIN635202

Cet anticorps anti-GCS1 est un anticorps Lapin Polyclonal détectant GCS1 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour GCS1 anticorps (N-Term) (ABIN635202)

Antigène: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCS1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GCS1 anticorps

Épitope: N-Term

Specificité: GCS1 antibody was raised against the N terminal of GCS1

Purification: Affinity purified

Immunogène: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCS1 Blocking Peptide, (ABIN938872), is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCS1

Antigène: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Autre désignation: GCS1

Sujet: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome