GCS1 anticorps (N-Term)

N° du produit ABIN635202

Détail du produit anti-GCS1 anticorps

Antigène: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GCS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GCS1 antibody was raised against the N terminal of GCS1

Purification: Affinity purified

Immunogène: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GCS1 Blocking Peptide, catalog no. 33R-3486, is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GCS1

Antigène: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Autre désignation: GCS1 (MOGS Produits)

Synonymes: anticorps Afu6g04210, anticorps AO090701000141, anticorps Mogs, anticorps CDG2B, anticorps CWH41, anticorps DER7, anticorps GCS1, anticorps 1810017N02Rik, anticorps AI181835, anticorps Gcs1, anticorps gcs1, anticorps im:7160827, anticorps wu:fe50a12, anticorps wu:fk09a10, anticorps zgc:158312, anticorps mannosyl-oligosaccharide glucosidase, anticorps mannosyl-oligosaccharide glucosidase GCS1, anticorps mannosyl-oligosaccharide glucosidase L homeolog, anticorps mannosyl oligosaccharide glucosidase, anticorps glucosidase 1, anticorps AFUA_6G04210, anticorps Tc00.1047053511015.10, anticorps Tc00.1047053511805.10, anticorps LOC5576381, anticorps AOR_1_260114, anticorps MGYG_00305, anticorps TERG_01248, anticorps mogs.L, anticorps TTHERM_00636930, anticorps LOAG_03690, anticorps Gcs1, anticorps MOGS, anticorps Mogs, anticorps mogs

Sujet: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Poids moléculaire: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome