SIGIRR anticorps
-
- Antigène Voir toutes SIGIRR Anticorps
- SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIGIRR est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
- Top Product
- Discover our top product SIGIRR Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIGIRR Blocking Peptide, catalog no. 33R-7406, is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGIRR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))
- Autre désignation
- SIGIRR (SIGIRR Produits)
- Synonymes
- anticorps TIR8, anticorps AI256711, anticorps sc:d148, anticorps RGD1306732, anticorps single Ig and TIR domain containing, anticorps single immunoglobulin and toll-interleukin 1 receptor (TIR) domain, anticorps SIGIRR, anticorps Sigirr, anticorps sigirr
- Sujet
- SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-