SIGIRR anticorps

N° du produit ABIN635203

Cet anticorps Lapin Polyclonal détecte spécifiquement SIGIRR dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SIGIRR anticorps (ABIN635203)

Antigène: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGIRR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIGIRR anticorps

Purification: Affinity purified

Immunogène: SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGIRR Blocking Peptide, (ABIN5616143), is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGIRR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGIRR

Antigène: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Autre désignation: SIGIRR

Sujet: SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades