MPG anticorps (C-Term)
-
- Antigène Voir toutes MPG Anticorps
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MPG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MPG antibody was raised against the C terminal of MPG
- Purification
- Affinity purified
- Immunogène
- MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
- Top Product
- Discover our top product MPG Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MPG Blocking Peptide, catalog no. 33R-4919, is also available for use as a blocking control in assays to test for specificity of this MPG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MPG (N-Methylpurine-DNA Glycosylase (MPG))
- Autre désignation
- MPG (MPG Produits)
- Sujet
- MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-